PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN36225.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HSF
Protein Properties Length: 269aa    MW: 29501.7 Da    PI: 9.3124
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN36225.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind83.53e-261072264
                  HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE CS
  HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkk 64
                  Fl+k+y+++ed+ ++++isw e+gn+fvv+++ +fak++LpkyFkh+nf+SFvRQLn+Y   +
    KHN36225.1 10 FLTKTYQLVEDQGTDQVISWGESGNTFVVWKHADFAKDLLPKYFKHNNFSSFVRQLNTYTNGN 72
                  9**********************************************************7555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.102.1E-27370IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004151.3E-336194IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467852.72E-22772IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004479.6E-221070IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000569.4E-161033IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000569.4E-164860IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000569.4E-166173IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MSQRSVPAPF LTKTYQLVED QGTDQVISWG ESGNTFVVWK HADFAKDLLP KYFKHNNFSS  60
FVRQLNTYTN GNSRTSISSE GRRSFSPRSN AARPCLNRRH MSGGDGNSPL NSGSDDAGST  120
STSSSSSGSK NQGSVETNTT PSHQLSSENE KLKKDNETLS CELARARKQC DELVAFLRDR  180
LMVGPDQIDR IMRQGSCGSE NVVGEGGGGD CLKLFGVWLK GDTLTDKRNN NKRGREDQMG  240
FGGPRLKESK PVVDFGAVNV MMKSNRVCN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5v_D6e-196682687Heat shock factor protein 1
5d5v_B6e-196682687Heat shock factor protein 1
5d5u_B6e-196682687Heat shock factor protein 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN8963040.0JN896304.1 Glycine max heat shock transcription factor HSFB1 mRNA, complete cds.
GenBankZ469530.0Z46953.1 G.max mRNA for heat shock transcription factor 34.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001241597.11e-156heat shock factor
SwissprotP223352e-64HSF24_SOLPE; Heat shock factor protein HSF24
TrEMBLA0A0B2RT270.0A0A0B2RT27_GLYSO; Heat shock factor protein HSF24
STRINGGLYMA01G39260.11e-156(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF71143247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36990.19e-55heat shock factor 4
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]